PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Migut.N03228.1.p
Common NameMIMGU_mgv1a002587mg
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Lamiales; Phrymaceae; Erythranthe
Family Trihelix
Protein Properties Length: 658aa    MW: 72212.5 Da    PI: 6.5298
Description Trihelix family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Migut.N03228.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1trihelix97.71e-3063150187
          trihelix   1 rWtkqevlaLiearremeerlrrgklkkplWeevskkmrergferspkqCkekwenlnkrykkikegekkrt.sessstcpyfdqlea 87 
                       rW++qe+laL+++r+em+ ++r+++lk+plWeevs+km+e gf+r+pk+Ckek+en+ k++k++k+g+++++     +t+++fdqlea
  Migut.N03228.1.p  63 RWPRQETLALLKIRSEMDVTFRDSSLKGPLWEEVSRKMAELGFQRNPKKCKEKFENVYKYHKRTKDGRSSKSdGAGGKTYRFFDQLEA 150
                       8*********************************************************************96356779********85 PP

2trihelix1055.4e-33470555187
          trihelix   1 rWtkqevlaLiearremeerlrrgklkkplWeevskkmrergferspkqCkekwenlnkrykkikegekkrtsessstcpyfdqlea 87 
                       rW+k ev aLi++r++++ +++++  k+plWee+s++m++ g++rs+k+Ckekwen+nk++kk+ke++kkr +e+s+tcpyf+ql+a
  Migut.N03228.1.p 470 RWPKAEVEALIKLRTNLDIKYQENGPKGPLWEEISSAMAKIGYNRSSKRCKEKWENINKYFKKVKESNKKR-PEDSKTCPYFHQLDA 555
                       8*********************************************************************8.99***********85 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM007170.006260122IPR001005SANT/Myb domain
PfamPF138371.6E-1962151No hitNo description
PROSITE profilePS500906.88862120IPR017877Myb-like domain
CDDcd122031.99E-2662127No hitNo description
PROSITE profilePS500907.909463527IPR017877Myb-like domain
Gene3DG3DSA:1.10.10.604.1E-5463526IPR009057Homeodomain-like
SMARTSM007173.5E-4467529IPR001005SANT/Myb domain
PfamPF138376.0E-23469556No hitNo description
CDDcd122036.69E-27470534No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 658 aa     Download sequence    Send to blast
MMLGVSGLMG SSGDGAAAAE AHESGGASGG SSEVGASSSI PGGGGGMEES ERSGGGGGGG  60
GNRWPRQETL ALLKIRSEMD VTFRDSSLKG PLWEEVSRKM AELGFQRNPK KCKEKFENVY  120
KYHKRTKDGR SSKSDGAGGK TYRFFDQLEA LENTTTTTPP PPHLFTTAAA PPPPRPPPLM  180
LTSSTAAAAA ALPMPPTVSS SNIIPANINN NPIINSSSFQ PSSGQPPPLQ HHLPPPPQPP  240
PSSNTIIPPQ GHAFQHSGGR PHMMPTRQLS DSTSNSSTSS DEDIQRRRRG RKRKWKDFFE  300
RVMKDVINKQ EDLQKRFLDT LEKRERDRTA REDAWRLQEI TRLNREHDLL VQERSIAAAK  360
DAAVISFLQK VTDQHNLQIP IANIFTAPPP PPPQVPPVQI QPPQIPQPPR QQQPPSMQLS  420
TIPPQPQQPT APPTTKPAVA APPAKIMDIV IADNGGGGDN SMSSAASSSR WPKAEVEALI  480
KLRTNLDIKY QENGPKGPLW EEISSAMAKI GYNRSSKRCK EKWENINKYF KKVKESNKKR  540
PEDSKTCPYF HQLDAIYRER GSKTDVVSFP GYGLNPDDNN PMMLPPPIMA RPEQQWPLPP  600
DEQRQQPDQF QDNESDHDEE EDDGDGDEDD EEDEAQCFEI VTNKQQSSVT TTTNAAD*
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
1287293RRGRKRK
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_012853467.10.0PREDICTED: LOW QUALITY PROTEIN: trihelix transcription factor GT-2-like
TrEMBLA0A022QBD20.0A0A022QBD2_ERYGU; Uncharacterized protein
STRINGSolyc12g056510.1.10.0(Solanum lycopersicum)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA24022459
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G76880.13e-51Trihelix family protein